General Information

  • ID:  hor006359
  • Uniprot ID:  O46541
  • Protein name:  Brain natriuretic peptide 29
  • Gene name:  NPPB
  • Organism:  Ovis aries (Sheep)
  • Family:  Natriuretic peptide family
  • Source:  animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0003008 system process; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MMRDSGCFGRRLDRIGSLSGLGCNVLRRY
  • Length:  29
  • Propeptide:  MDPQKALSRTLLLLLFLHLSLLGCRSHPLGGPGSASELPGLQELLDRLRDRVSELQAEQLRVEPLQQGQGLEETWDSPAAAPAGFLGPHHSLLQALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY
  • Signal peptide:  MDPQKALSRTLLLLLFLHLSLLGCRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (By similarity). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in turn activates effector proteins that drive various biological responses. Involved in regulating the extracellular fluid volume and maintaining the fluid-electrolyte balance through natriuresis, diuresis, vasorelaxation, and inhibition of renin and aldosterone secretion. Binds the clearance receptor NPR3 (By similarity).
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR1
  • Target Unid:  W5NRW5
  • IC50: NA
  • EC50: NA
  • ED50: NA
  • kd: Kd=16pM for receptor binding ( PubMed ID: 11054637 )
  • Half life: 3.1 minutes; /186 seconds ( PubMed ID: 11054637 )

Structure

  • Disulfide bond:  7-23
  • Structure ID:  AF-O46541-F1(AlphaFold_DB_ID)

  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
    •    hor006359_AF2.pdbhor006359_ESM.pdb

Physical Information

Mass: 378947 Formula: C136H230N48O39S4
Absent amino acids: AEHKPQTW Common amino acids: R
pI: 10.9 Basic residues: 6
Polar residues: 12 Hydrophobic residues: 7
Hydrophobicity: -26.55 Boman Index: -8036
Half-Life: 30 hour Half-Life Yeast: >20 hour
Half-Life E.Coli: >10 hour Aliphatic Index 77.24
Instability Index: 5364.83 Extinction Coefficient cystines: 1615
Absorbance 280nm: 57.68

Literature

  • PubMed ID:  10219521##11054637
  • Title:  The characterization of ovine genes for atrial, brain, and C-type natriuretic peptides.