General Information

  • ID:  hor006359
  • Uniprot ID:  O46541
  • Protein name:  Brain natriuretic peptide 29
  • Gene name:  NPPB
  • Organism:  Ovis aries (Sheep)
  • Family:  Natriuretic peptide family
  • Source:  Animal
  • Expression:  NA
  • Disease:  NA
  • Comments:  NA
  • Taxonomy:   Ovis (genus), Caprinae (subfamily), Bovidae (family), Pecora (infraorder), Ruminantia (suborder), Artiodactyla (order), Laurasiatheria (superorder), Boreoeutheria , Eutheria , Theria , Mammalia (class), Amniota , Tetrapoda , Dipnotetrapodomorpha , Sarcopterygii (superclass), Euteleostomi , Teleostomi , Gnathostomata , Vertebrata , Craniata (subphylum), Chordata (phylum), Deuterostomia , Bilateria , Eumetazoa , Metazoa (kingdom), Opisthokonta , Eukaryota (superkingdom),cellular organisms
  • GO MF:  GO:0005179 hormone activity
  • GO BP:  GO:0003008 system process; GO:0006182 cGMP biosynthetic process; GO:0007168 receptor guanylyl cyclase signaling pathway; GO:0097746 blood vessel diameter maintenance
  • GO CC:  GO:0005576 extracellular region

Sequence Information

  • Sequence:  MMRDSGCFGRRLDRIGSLSGLGCNVLRRY
  • Length:  29(101-129)
  • Propeptide:  MDPQKALSRTLLLLLFLHLSLLGCRSHPLGGPGSASELPGLQELLDRLRDRVSELQAEQLRVEPLQQGQGLEETWDSPAAAPAGFLGPHHSLLQALRGPKMMRDSGCFGRRLDRIGSLSGLGCNVLRRY
  • Signal peptide:  MDPQKALSRTLLLLLFLHLSLLGCRS
  • Modification:  NA
  • Glycosylation:  NA
  • Mutagenesis:  NA

Activity

  • Function:  Cardiac hormone that plays a key role in mediating cardio-renal homeostasis (By similarity). May also function as a paracrine antifibrotic factor in the heart (By similarity). Acts by specifically binding and stimulating NPR1 to produce cGMP, which in tur
  • Mechanism:  NA
  • Cross BBB:  NA
  • Target:  NPR1
  • Target Unid:   W5NRW5
  • IC50:  NA
  • EC50:  NA
  • ED50:  NA
  • Kd:  Kd=16pM for receptor binding ( PubMed ID: 11054637 )
  • Half life:  3.1 minutes; /186 seconds ( PubMed ID: 11054637 )

Structure

  • Disulfide bond:  45861
  • Structure ID:  AF-O46541-F1(AlphaFold_DB_ID)
  • Structure: (PDB_ID-from https://www.rcsb.org/; AlphaFold_DB_ID-from https://alphafold.ebi.ac.uk/; hordbxxxxxx_AF2.pdb was predicted structure by AlphaFold2; hordbxxxxxx_ESM.pdb was predicted structure by ESMFold)
  •    hor006359_AF2.pdbhor006359_ESM.pdb

Physical Information

Mass: 378947 Formula: C136H230N48O39S4
Absent amino acids: AEHKPQTW Common amino acids: R
pI: 10.9 Basic residues: 6
Polar residues: 12 Hydrophobic residues: 7
Hydrophobicity: -26.55 Boman Index: -8036
Half-Life / Aliphatic Index: 30 hour Aliphatic Index: 77.24
Instability Index: 5364.83 Extinction Coefficient cystines: 1615
Absorbance 280nm: 57.68

Literature

  • PubMed ID:  10219521##11054637
  • Title:  The characterization of ovine genes for atrial, brain, and C-type natriuretic peptides.